C1orf184 Rabbit Polyclonal Antibody TA331031 from OriGene Technologies | Biocompare.com

Supplier Images

METTL11B Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C1orf184 Rabbit Polyclonal Antibody

OriGene Technologies' C1orf184 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The C1orf184 Rabbit Polyclonal Antibody was generated using N-terminal Xaa-Pro-Lys N-methyltransferase 2, and NTMT2 as the antigen and it reacts with Human.

Description

Rabbit polyclonal Anti-C1orf184 Antibody

Product Specs
ItemC1orf184 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA331031
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetC1orf184
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C1orf184 antibody: synthetic peptide directed towards the C terminal of human C1orf184. Synthetic peptide located within the following region: NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
NCBI Full Gene NameN-terminal Xaa-Pro-Lys N-methyltransferase 2
NCBI Gene AliasesC1orf184, HOMT1B, METTL11B, NTM1B

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!